HPA007477

TBL2 antibody from Sigma-Aldrich
DKFZP43N024, WBSCR13, WS-betaTRP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007477
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007477, RRID:AB_1080214
Product name
Anti-TBL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007477
Antibody type
Polyclonal
Antigen
Transducin beta-like 2 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLKGQVLSTINTNQMNNTHAAVSPCGRFVASCGFT
PDVKVWEVCFGKKGEFQEVVRAFELKGHSAAVHSF
AFSNDSRRMASVSKDGTWKLWDTDVEYKKKQDPY
Storage
-20C
Provider Type Product Number
- No reagents -