Antibody data

Product number
ABIN309769
Provider
antibodies-online
Product name
anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5) (N-Term) antibody
Provider product page
antibodies-online - ABIN309769
Antibody type
Polyclonal
Antigen
The immunogen for anti-TRPM5 antibody: synthetic peptide directed towards the N terminal of human TRPM5
Description
Affinity Purified
Reactivity
Human, Mouse, Canine
Host
Rabbit
Antigen sequence
EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLER
ISRAV EQAAPWLILV
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -