AV35243

TRPM5 antibody from Sigma-Aldrich
LTRPC5, MTR1
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV35243
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV35243, RRID:AB_1858369
Product name
Anti-TRPM5 (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV35243
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human TRPM5 with an internal ID of P06477
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
ILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKF
PSKHFSWEDIVRWTK
Storage
-20C
Provider Type Product Number
- No reagents -