Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002644-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002644-D01P, RRID:AB_1674117
- Product name
- GCHFR purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human GCHFR protein.
- Antigen sequence
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGAS
KRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSM
TGVGQTLVWCLHKE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The protein partners of GTP cyclohydrolase I in rat organs.
Du J, Teng RJ, Lawrence M, Guan T, Xu H, Ge Y, Shi Y
PloS one 2012;7(3):e33991
PloS one 2012;7(3):e33991
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GCHFR expression in transfected 293T cell line (H00002644-T02) by GCHFR MaxPab polyclonal antibody.Lane 1: GCHFR transfected lysate(9.70 KDa).Lane 2: Non-transfected lysate.