Antibody data

Product number
ABIN504476
Provider
antibodies-online
Product name
anti-Guanine Nucleotide Binding Protein (G Protein), alpha 15 (Gq Class) (GNA15) antibody
Provider product page
antibodies-online - ABIN504476
Antibody type
Polyclonal
Antigen
The immunogen for anti-GNA15 antibody: synthetic peptide directed towards the N terminal of human GNA15
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQK
KQDRG ELKLLLLGPG
Vial size
50 µg
Provider Type Product Number
- No reagents -