HPA007478

XYLT1 antibody from Sigma-Aldrich
PXYLT1, XT-I
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007478
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007478, RRID:AB_1080616
Product name
Anti-XYLT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007478
Antibody type
Polyclonal
Antigen
Xylosyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEE
ALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVE
QARRNAASTGTALEGWLDSLVGGMWTAMDICATGP
TACPVMQTCSQTAWSSFSPDPKSELG
Storage
-20C
Provider Type Product Number
- No reagents -