HPA008576

IGDCC4 antibody from Sigma-Aldrich
LOC57722, NOPE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008576
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008576, RRID:AB_1079496
Product name
Anti-IGDCC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008576
Antibody type
Polyclonal
Antigen
Neighbor of punc e11 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEDRAEVHSLMGGGVSEGRSHSKRKISWAQPSGLS
WAGSWAGCELPQAGPRPALTRALLPPAGTGQTLLL
QALVYDAIKGNGRKKSPPACRNQVEAEVIVHSDFS
ASNGNPDLHLQDLEPEDPLPPEAPDLISGVGD
Storage
-20C
Provider Type Product Number
- No reagents -