HPA011140

GALNTL5 antibody from Sigma-Aldrich
GalNAc-T5L, GALNT15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011140
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011140, RRID:AB_1078944
Product name
Anti-GALNTL5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011140
Antibody type
Polyclonal
Antigen
Putative polypeptide N-acetylgalactosaminyltransferase-like protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRT
LEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGS
TKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMD
Storage
-20C
Provider Type Product Number
- No reagents -