HPA053222

FAM177A1 antibody from Atlas Antibodies
C14orf24
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA053222
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA053222, RRID:AB_2682083
Product name
Anti-FAM177A1
Provider product page
Atlas Antibodies - HPA053222
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSF
VNVNFEMEGDSEVIMESKQNPVSVP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -