HPA055440

FAM177A1 antibody from Atlas Antibodies
C14orf24
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA055440
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055440, RRID:AB_2682817
Product name
Anti-FAM177A1
Provider product page
Atlas Antibodies - HPA055440
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVS
GETMEEYSTDEDEVDGVEKKDV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -