Antibody data

Product number
H00283635-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00283635-D01P, RRID:AB_10551230
Product name
FAM177A1 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00283635-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human FAM177A1 protein.
Antigen sequence
MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSN
ERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYS
TDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLR
AATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYY
RMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQ
TDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVS
VPP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -