SAB1402079

FAM177A1 antibody from Sigma-Aldrich
C14orf24
No application information provided.

Antibody data

Product number
SAB1402079
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1402079, RRID:AB_10609710
Product name
Anti-FAM177A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1402079
Antibody type
Polyclonal
Antigen
FAM177A1 (NP_001072987.1, 1 - 213 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSN
ERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYS
TDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLR
AATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYY
RMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQ
TDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVS
VPP
Storage
-20C
Provider Type Product Number
- No reagents -