HPA012820

FKTN antibody from Sigma-Aldrich
FCMD, LGMD2M
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012820
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012820, RRID:AB_1848478
Product name
Anti-FKTN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012820
Antibody type
Polyclonal
Antigen
Fukutin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HYLSTKNGAGLSKSKGSRIGFDSTQWRAVKKFIML
TSNQNVPVFLIDPLILELINKNFEQVKNTSHGSTS
QCKFFCVPRDFTAFALQYHLWKNEEGWFRIAENMG
FQCLKIESKDPRLDGIDSLSGTEIPLHYICKLATH
AIHLV
Storage
-20C
Provider Type Product Number
- No reagents -