Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184310 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Factor I/C (CCAAT-Binding Transcription Factor) (NFIC) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NFIC antibody: synthetic peptide directed towards the C terminal of human NFIC
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
VRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQE
SFVTS GVFSVTELIQ- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Stimulation of BK virus DNA replication by NFI family transcription factors.
BAF complex is closely related to and interacts with NF1/CTF and RNA polymerase II in gene transcriptional activation.
Liang B, Tikhanovich I, Nasheuer HP, Folk WR
Journal of virology 2012 Mar;86(6):3264-75
Journal of virology 2012 Mar;86(6):3264-75
BAF complex is closely related to and interacts with NF1/CTF and RNA polymerase II in gene transcriptional activation.
Zhao LH, Ba XQ, Wang XG, Zhu XJ, Wang L, Zeng XL
Acta biochimica et biophysica Sinica 2005 Jul;37(7):440-6
Acta biochimica et biophysica Sinica 2005 Jul;37(7):440-6
No comments: Submit comment
No validations: Submit validation data