WH0057617M2

VPS18 antibody from Sigma-Aldrich
KIAA1475, PEP3
ELISA
Recommended by provider

Antibody data

Product number
WH0057617M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0057617M2, RRID:AB_1844209
Product name
Monoclonal Anti-VPS18 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0057617M2
Antibody type
Monoclonal
Antigen
VPS18 (NP_065908, a.a. 3-101) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse
Antigen sequence
SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQL
EKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLG
KDTLLRIDLGKANEPNHVELGRKDDAKV* (with
out GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -