Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057617-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057617-M02, RRID:AB_566268
- Product name
- VPS18 monoclonal antibody (M02), clone 2G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant VPS18.
- Antigen sequence
SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQL
EKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLG
KDTLLRIDLGKANEPNHVELGRKDDAKV- Isotype
- IgG
- Antibody clone number
- 2G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The cellular factors Vps18 and Mon2 are required for efficient production of infectious HIV-1 particles.
Tomita Y, Noda T, Fujii K, Watanabe T, Morikawa Y, Kawaoka Y
Journal of virology 2011 Jun;85(11):5618-27
Journal of virology 2011 Jun;85(11):5618-27
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- VPS18 monoclonal antibody (M02), clone 2G10. Western Blot analysis of VPS18 expression in Raw 264.7.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged VPS18 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol