Antibody data

Product number
H00057617-M02
Provider
Novus Biologicals
Proper citation
Novus Cat#H00057617-M02, RRID:AB_830404
Product name
Mouse Monoclonal VPS18 Antibody
Provider product page
Novus Biologicals - H00057617-M02
Antibody type
Monoclonal
Antigen
VPS18 (NP_065908, 3 a.a. ~ 101 a.a) partial recombinant protein with GST tag. SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV
Description
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Reactivity
Human, Mouse
Host
Mouse
Isotype
IgG
Vial size
0.05 mg
Storage
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Provider Type Product Number
- No reagents -