HPA040400

SARAF antibody from Atlas Antibodies
MGC8721, TMEM66

Antibody data

Product number
HPA040400
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040400, RRID:AB_2676962
Product name
Anti-SARAF
Provider product page
Atlas Antibodies - HPA040400
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFT
GPQNTGHGATSGFGSAFT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -