HPA030587

ZNF343 antibody from MilliporeSigma / Merck KGaA
MGC10715
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030587
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ZNF343 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030587
Antibody type
Polyclonal
Antigen
zinc finger protein 343 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLPYPSALGDQYWEEILLPKNGENVETMKKLTQNH
KAKGLPSNDTDCPQKKEGKAQIVVPVTFRDVTV
Storage
-20C