HPA041953

DOHH antibody from Atlas Antibodies
HLRC1, MGC4293
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA041953
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041953, RRID:AB_10795386
Product name
Anti-DOHH
Provider product page
Atlas Antibodies - HPA041953
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RFRALFTLRGLGGPGAIAWISQAFDDDSALLKHEL
AYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGE
ALGAIGDPEVLEILKQYSSDP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -