HPA011862

ENG antibody from Sigma-Aldrich
CD105, END, HHT1, ORW, ORW1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011862
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011862, RRID:AB_1846217
Product name
Anti-ENG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011862
Antibody type
Polyclonal
Antigen
Endoglin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPP
KDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLK
CTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQV
SASMISNEAVVNILSSSSPQRK
Storage
-20C
Provider Type Product Number
- No reagents -