Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051266-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051266-M02, RRID:AB_1112504
- Product name
- CLEC1B monoclonal antibody (M02), clone 1C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CLEC1B.
- Antigen sequence
QYCTDMNATLLKIDNRNIVEYIKARTHLIRWVGLS
RQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAY
FHNGKMHPTFCENKHYLMCERKAGMTKVDQLP- Isotype
- IgG
- Antibody clone number
- 1C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references C-type lectin like receptor 2 (CLEC-2) signals independently of lipid raft microdomains in platelets.
Manne BK, Badolia R, Dangelmaier CA, Kunapuli SP
Biochemical pharmacology 2015 Jan 15;93(2):163-70
Biochemical pharmacology 2015 Jan 15;93(2):163-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CLEC1B is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CLEC1B transfected lysate using anti-CLEC1B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CLEC1B MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol