Antibody data

Product number
HPA038396
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA038396, RRID:AB_10795356
Product name
Anti-ANAPC4
Provider product page
Atlas Antibodies - HPA038396
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTE
HFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSP
PNTEGNQWYDFLQN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.