SAB1401662

ANAPC4 antibody from MilliporeSigma / Merck KGaA
APC4
No application information provided.

Antibody data

Product number
SAB1401662
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ANAPC4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB1401662
Antibody type
Polyclonal
Antigen
ANAPC4 (NP_037499.2, 1 a.a. ~ 808 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLI
ALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTC
LAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFS
VEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLP
KLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNI
LVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCL
SSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFL
PEVTRMARKF
Storage
-20C