HPA008214

PLGRKT antibody from Atlas Antibodies
AD025, C9orf46, FLJ14688, MDS030, Plg-RKT
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008214
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008214, RRID:AB_1078363
Product name
Anti-PLGRKT
Provider product page
Atlas Antibodies - HPA008214
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWS
RE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -