HPA008214

PLGRKT antibody from Sigma-Aldrich
AD025, C9orf46, FLJ14688, MDS030, Plg-RKT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008214
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008214, RRID:AB_1078363
Product name
Anti-C9orf46 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008214
Antibody type
Polyclonal
Antigen
Transmembrane protein C9orf46
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWS
RE
Storage
-20C
Provider Type Product Number
- No reagents -