H00283420-B01P

CLEC9A antibody from Abnova Corporation
CD370, DNGR-1, HEEE9341, UNQ9341

Antibody data

Product number
H00283420-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00283420-B01P, RRID:AB_1573070
Product name
CLEC9A purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00283420-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CLEC9A protein.
Antigen sequence
MHEEEIYTSLQWDSPAPDTYQKCLSSNKCSGACCL
VMVISCVFCMGLLTASIFLGVKLLQVSTIAMQQQE
KLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLS
SAHNSSPCPNNWIQNRESCYYVSEIWSIWHTSQEN
CLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWV
GLSQDGHSGRWLWQDGSSPSPGLLPAERSQSANQV
CGYVKSNSLLSSNCSTWKYFICEKYALRSSV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -