HPA007537

SGCA antibody from Sigma-Aldrich
A2, adhalin, ADL, DMDA2, LGMD2D, SCARMD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007537
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007537, RRID:AB_1079944
Product name
Anti-SGCA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007537
Antibody type
Polyclonal
Antigen
alpha-Sarcoglycan precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLK
MVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCN
VTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEA
PDRDFLVD
Storage
-20C
Provider Type Product Number
- No reagents -