HPA051482

ANXA2R antibody from Atlas Antibodies
AXIIR, C5orf39
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA051482
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051482, RRID:AB_2681500
Product name
Anti-ANXA2R
Provider product page
Atlas Antibodies - HPA051482
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQST
LEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -