AV54435

ANXA2R antibody from Sigma-Aldrich
AXIIR, C5orf39
No application information provided.

Antibody data

Product number
AV54435
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV54435, RRID:AB_1845725
Product name
Anti-C5ORF39 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV54435
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human C5orf39 with an internal ID of P31215
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPW
PLPLYPVLGEYSLDS
Storage
-20C
Provider Type Product Number
- No reagents -