Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007690-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007690-M07, RRID:AB_566277
- Product name
- ZNF131 monoclonal antibody (M07), clone 5F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNF131.
- Antigen sequence
TSKYRQGDRKGQIKEDGCPSDPTSKQEHMKSHSTE
SFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQ
RTGKKIHVCQYCEKQFDHFGHFKEHLRKHT- Isotype
- IgG
- Antibody clone number
- 5F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Kaiso regulates Znf131-mediated transcriptional activation.
Donaldson NS, Nordgaard CL, Pierre CC, Kelly KF, Robinson SC, Swystun L, Henriquez R, Graham M, Daniel JM
Experimental cell research 2010 Jun 10;316(10):1692-705
Experimental cell research 2010 Jun 10;316(10):1692-705
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ZNF131 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ZNF131 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol