H00064581-B02
antibody from Abnova Corporation
Targeting: CLEC7A
CD369, CLECSF12, dectin-1, hDectin-1, SCARE2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064581-B02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064581-B02, RRID:AB_938711
- Product name
- CLEC7A MaxPab mouse polyclonal antibody (B02)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human CLEC7A protein.
- Antigen sequence
MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKG
SCAASPPWRLIAVILGILCLVILVIAVVLGTMAGF
KAVEFKG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CLEC7A expression in transfected 293T cell line (H00064581-T02) by CLEC7A MaxPab polyclonal antibody.Lane 1: CLEC7A transfected lysate(8.47 KDa).Lane 2: Non-transfected lysate.