H00025979-B01P

DHRS7B antibody from Abnova Corporation
CGI-93, DKFZp566O084, MGC8916, SDR32C1

Antibody data

Product number
H00025979-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025979-B01P, RRID:AB_1573314
Product name
DHRS7B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00025979-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human DHRS7B protein.
Antigen sequence
MVSPATRKSLPKVKAMDFITSTAILPLLFGCLGVF
GLFRLLQWVRGKAYLRNAVVVITGATSGLGKECAK
VFYAAGAKLVLCGRNGGALEELIRELTASHATKVQ
THKPYLVTFDLTDSGAIVAAAAEILQCFGYVDILV
NNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTK
ALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAAS
KHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLS
VNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAV
GKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASR
ARKERKSKNS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -