HPA016873

DHRS7B antibody from Sigma-Aldrich
CGI-93, DKFZp566O084, MGC8916, SDR32C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016873, RRID:AB_1847657
Product name
Anti-DHRS7B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016873
Antibody type
Polyclonal
Antigen
Dehydrogenase/reductase SDR family member 7B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLGKECAKVFYAAGAKLVLCGRNGGALEELIRELT
ASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQC
FGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNY
FGPVALTKALLPS
Storage
-20C
Provider Type Product Number
- No reagents -