HPA016873

DHRS7B antibody from Atlas Antibodies
CGI-93, DKFZp566O084, MGC8916, SDR32C1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016873
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016873, RRID:AB_1847657
Product name
Anti-DHRS7B
Provider product page
Atlas Antibodies - HPA016873
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLGKECAKVFYAAGAKLVLCGRNGGALEELIRELT
ASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQC
FGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNY
FGPVALTKALLPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -