Antibody data

Product number
ABIN405999
Provider
antibodies-online
Product name
anti-3-Hydroxy-3-Methylglutaryl-CoA Synthase 1 (Soluble) (HMGCS1) antibody
Provider product page
antibodies-online - ABIN405999
Antibody type
Polyclonal
Antigen
The immunogen for anti-HMGCS1 antibody: synthetic peptide directed towards the middle region of human HMGCS1
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus
Host
Rabbit
Antigen sequence
KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLN
DQNRD KNSIYSGLEA
Vial size
50 µg
Provider Type Product Number
- No reagents -