Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108221 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chromosome 19 Open Reading Frame 28 (C19orf28) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide corresponding to the N-terminal region of human MFSD12
- Description
- Immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLC
ASMWFTYLLLYLHSV- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human THP-1; WB Suggested Anti-C19orf28 Antibody Titration: 0.2-1 ug/ml. Positive Control: THP-1 cell lysate; C19orf28 antibody - N-terminal region (AP46039PU-N) in Human THP-1 cells using Western Blot