HPA046602

SPSB3 antibody from Atlas Antibodies
C16orf31, SSB-3

Antibody data

Product number
HPA046602
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA046602, RRID:AB_2679717
Product name
Anti-SPSB3
Provider product page
Atlas Antibodies - HPA046602
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSP
VYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSW
GLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWH
GTLTFFKNRKCIGVAATKLQNKRFYPMVC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.