H00010362-M01
antibody from Abnova Corporation
Targeting: HMG20B
BRAF25, BRAF35, HMGX2, HMGXB2, SMARCE1r, SOXL
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010362-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010362-M01, RRID:AB_489916
- Product name
- HMG20B monoclonal antibody (M01), clone 1F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HMG20B.
- Antigen sequence
MLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAY
QQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGH
KGGDCDGFSTFDVPIFTEEFLDQNKAREAELRRLR
KMNV- Isotype
- IgG
- Antibody clone number
- 1F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Control of neuronal differentiation by sumoylation of BRAF35, a subunit of the LSD1-CoREST histone demethylase complex.
Ceballos-Chávez M, Rivero S, García-Gutiérrez P, Rodríguez-Paredes M, García-Domínguez M, Bhattacharya S, Reyes JC
Proceedings of the National Academy of Sciences of the United States of America 2012 May 22;109(21):8085-90
Proceedings of the National Academy of Sciences of the United States of America 2012 May 22;109(21):8085-90
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HMG20B monoclonal antibody (M01), clone IF6 Western Blot analysis of HMG20B expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of HMG20B in extracts from 293T, HeLa and A549 cell using anti-HMG20B monoclonal antibody.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HMG20B on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HMG20B on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 1.8 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol