PAB20571

DNAJC4 antibody from Abnova Corporation
HSPF2, MCG18

Antibody data

Product number
PAB20571
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20571, RRID:AB_10963171
Product name
DNAJC4 polyclonal antibody
Provider product page
Abnova Corporation - PAB20571
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant DNAJC4.
Antigen sequence
GASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVE
LSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVH
DKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQ
QHKQNKQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -