HPA052271

OIP5 antibody from Atlas Antibodies
CT86, hMIS18beta, MIS18B

Antibody data

Product number
HPA052271
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052271, RRID:AB_2681780
Product name
Anti-OIP5
Provider product page
Atlas Antibodies - HPA052271
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVC
YLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLT
HNRLKSLMKILSEVT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.