ABIN630728

antibody from antibodies-online

Targeting: NUSAP1 ANKT, BM037, FLJ13421, LNP, PRO0310p1, Q0310, SAPL

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630728 - Provider product page
Provider: antibodies-online
Product name: anti-Nucleolar and Spindle Associated Protein 1 (NUSAP1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: NUSAP1 antibody was raised using the middle region of NUSAP1 corresponding to a region with amino acids AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

NUSAP1 protein structure - ABIN630728 shown in red.