HPA042904

antibody from Atlas Antibodies

Targeting: NUSAP1 ANKT, BM037, FLJ13421, LNP, PRO0310p1, Q0310, SAPL

Antibody data

Submit

Validation data

Product number: HPA042904 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042904, RRID:AB_2678220
Product name: Anti-NUSAP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KLLKALKGYIKHEARKGNENQDESQTSASSCDETE IQISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQ NHSEIKISNPTEFQNHEKQESQDFRATAKVPSPPD EHQEAENAVSSGNRDSKV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NUSAP1 protein structure - HPA042904 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using HPA042904 antibody. Corresponding NUSAP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows strong nuclear positivity in subsets of germinal center cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows moderate nuclear positivity in germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neuronal cells as expected.
Sample type: HUMAN