H00126326-M01

GIPC3 antibody from Abnova Corporation
C19orf64, DFNB15, DFNB72, DFNB95

Antibody data

Product number
H00126326-M01
Provider
Abnova Corporation
Product name
GIPC3 monoclonal antibody (M01), clone 8H8
Provider product page
Abnova Corporation - H00126326-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GIPC3.
Antigen sequence
AKVTSGRETLRLRSGGAATVEEAPSEFEEEASRKV
DDLLESYMGIRDPELASTMVETSKKTASAQEFARC
LDSVLGEFAFPDEFVVEVWAAIGEAREAC
Isotype
IgG
Antibody clone number
8H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -