HPA012955

GALNT18 antibody from Sigma-Aldrich
GalNAc-T18, GALNT15, GALNTL4, MGC71806
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012955
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012955, RRID:AB_1849460
Product name
Anti-GALNTL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012955
Antibody type
Polyclonal
Antigen
Putative polypeptide N-acetylgalactosaminyltransferase-like protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDIIAYGVLQNSLKTDLCLDQGPDTENVPIMYICH
GMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDV
NSRPRLIECSYAKAKRMKLHWQFSQGGPIQNRKSK
RCLELQENSDLEFGFQLVLQKCSGQHWSITNVL
Storage
-20C
Provider Type Product Number
- No reagents -