Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003029-M02A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003029-M02A, RRID:AB_733171
- Product name
- HAGH monoclonal antibody (M02A), clone 2F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HAGH.
- Antigen sequence
GRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIRE
KLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREK
TVQQHAGETDPVTTMRAVRREKDQFKMPRD- Isotype
- IgG
- Antibody clone number
- 2F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HAGH monoclonal antibody (M02A), clone 2F9 Western Blot analysis of HAGH expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HAGH expression in transfected 293T cell line by HAGH monoclonal antibody (M02A), clone 2F9.Lane 1: HAGH transfected lysate (Predicted MW: 29.9 KDa).Lane 2: Non-transfected lysate.