Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405766 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proteasome (Prosome, Macropain) Assembly Chaperone 1 (PSMG1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSMG1 antibody: synthetic peptide directed towards the middle region of human PSMG1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Rabbit
- Host
- Rabbit
- Antigen sequence
VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEIL
KKLMT TNEIQSNIYT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cooperation of multiple chaperones required for the assembly of mammalian 20S proteasomes.
Hirano Y, Hayashi H, Iemura S, Hendil KB, Niwa S, Kishimoto T, Kasahara M, Natsume T, Tanaka K, Murata S
Molecular cell 2006 Dec 28;24(6):977-84
Molecular cell 2006 Dec 28;24(6):977-84
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting