H00057593-B01

EBF4 antibody from Abnova Corporation
COE4, KIAA1442, O/E-4, RP5-860F19.3

Antibody data

Product number
H00057593-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057593-B01, RRID:AB_1114124
Product name
EBF4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00057593-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EBF4 protein.
Antigen sequence
MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISA
VKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFE
DSDKFHSPARGLQGLAYS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -