Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404839 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Early B-Cell Factor 4 (EBF4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EBF4 antibody: synthetic peptide directed towards the middle region of human EBF4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LYPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERD
AAQEA EAGTGLEPGS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references [Effects of SCL antisense ooligonucleotides on K562 and CEM cell lines].
Cloning of a novel Olf-1/EBF-like gene, O/E-4, by degenerate oligo-based direct selection.
Zheng ZJ, Hu JD, Huang SH, Wang SY, Lu LH
Zhongguo shi yan xue ye xue za zhi / Zhongguo bing li sheng li xue hui = Journal of experimental hematology / Chinese Association of Pathophysiology 2002 Oct;10(5):404-8
Zhongguo shi yan xue ye xue za zhi / Zhongguo bing li sheng li xue hui = Journal of experimental hematology / Chinese Association of Pathophysiology 2002 Oct;10(5):404-8
Cloning of a novel Olf-1/EBF-like gene, O/E-4, by degenerate oligo-based direct selection.
Wang SS, Betz AG, Reed RR
Molecular and cellular neurosciences 2002 Jul;20(3):404-14
Molecular and cellular neurosciences 2002 Jul;20(3):404-14
No comments: Submit comment
No validations: Submit validation data