PAB20496

KIAA1549L antibody from Abnova Corporation
C11orf41, C11orf69, G2, MGC34830

Antibody data

Product number
PAB20496
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20496, RRID:AB_10961699
Product name
C11orf41 polyclonal antibody
Provider product page
Abnova Corporation - PAB20496
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human C11orf41.
Reactivity
Human
Host
Rabbit
Antigen sequence
PASASKQVRASPSSMDVYDSLTIGDMKKPATTDVF
WSSLSAETGSLSTESIISGLQQQTNYDLNGHTIST
TSWETHLAPTAPPNGLTSAADAIKSQDFKDTAGHS
VTAEGFSIQDLVLGT
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -